OD1 – Ion Channels and Transporters

OD1 is a scorpion peptide that has been isolated initially from the venom of the scorpion Odonthobuthus doriae. OD1 potently inhibits fast inactivation of mammalian channels Nav1.7 (EC50 4.5 nM), Nav1.4 (EC50 10 ± 2 nM) and Nav1.6 (EC50 47 ± 10 nM). OD1 also blocks fast inactivation of the para/tipE insect channel (EC50 80 nM). OD1 weakly affects mammalian Nav1.3 and Nav1.5 (EC50 > 1 μM) and does not affect Nav1.2 and Nav1.8. OD1 induces spontaneous pain when injected in animal in association with our without Veratridine and can be used to test the analgesic effects of Nav1.7 blockers in-vivo.

Technical specification

	Sequence :	H-GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2 (Cys13-Cys64; Cys17-Cys37; Cys23-Cys47; Cys27-Cys49)
	MW :	7206.07 g/mol
	Purity :	> 95%
	Counter-Ion :	TFA Salts
	Delivery format :	Lyophilized

Price

Product	Size	Price €	Price $
ODX001-0.01 mg	0.01 mg	110 €	88 $
ODX001-0.1 mg	0.1 mg	308 €	247 $
ODX001-0.5 mg	0.5 mg	924 €	740 $
ODX001-5 x 0.01 mg	5 x 0.01 mg	220 €	176 $
ODX001-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

OD1 – Ion Channels and Transporters

Technical specification

Price

For Bulk Orders