MitTx (MitTx-α + MitTx-β) – Ion Channels and Transporters

MitTx is a peptide isolated from the Venom of the Texas coral snake Micrurus tener tener. MitTx is a selective agonist for acid-sensing ion channels 1 (ASIC1s) and produces a similar effect than pH drops. MitTx activates both ASIC1a & ASIC1b with a higher selectivity for ASIC1a (EC50 = 9.4 nM) compared to the ASIC1b (EC50= 23 nM). MitTx also demonstrates an activity for ASIC3 with a lower potency (EC50=830 nM).The venom toxin MitTx is an heterodimer composed of an α subunit of ~ 7 kDa and a β subunit of ~ 13.5 kDa. These two subunits when isolated do not present activity against ASIC channels. In vivo, the heterodimer elicits a robust pain-related behavior in mice by activation of ASIC1 channels on capsaicin-sensitive nerve fibers

 

Technical specification

 KD20 peptide Sequence : MitTx-α subunit: QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG (Cys31-Cys82; Cys41-Cys65; Cys57-Cys78)

MitTx-β subunit: NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPL
VMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ (Cys41-Cys100; Cys55-Cys148; Cys57-Cys73; Cys72-Cys130; Cys79-Cys123; Cys89-Cys116; Cys109-Cys121)

 KD20 peptide MW : 7121 g/mol; 13736.58 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price €
Price $
MTX002-0.01 mg 0.01 mg 275 € 220 $
MTX002-5 x 0.01 mg 5 x 0.01 mg 1 100 € 880 $
MTX002-
MTX002-
MTX002-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders