Margatoxin – Ion Channels and Transporters

Margatoxin (MgTx) is a component of the venom of Scorpio Centruroides margaritatus. Margatoxin preferentially inhibits voltage-dependent potassium channels Kv1.3 with an IC50 value around 50 pM (20 fold more potent than Charybdotoxin) and irreversibly inhibits the proliferation response of human T-cells at 20 µM concentration. Margatoxin is known to be less potent on Kv1.3 expressed in Xenopus Oocytes (IC50 around 1 nM). Margatoxin was also described to be a potent inhibitor of human vascular smooth muscle cell migration with an IC50 of 85 pM.

 

Technical specification

 KD20 peptide Sequence : H-TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH-OH (Cys7-Cys29; Cys13-Cys34; Cys17-Cys36)
 KD20 peptide MW : 4179.02 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price €
Price $
08MAG001-0.1 mg 0.1 mg 149 € 119 $
08MAG001-0.5 mg 0.5 mg 418 € 335 $
08MAG001-1 mg 1 mg 583 € 467 $
08MAG001-
08MAG001-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders