Kaliotoxin-1 – Ion Channels and Transporters

Kaliotoxin-1 (KTX1) has been isolated from the venom of the Scorpion Androctonus mauretanicus mauretanicus. Kaliotoxin-1 shows a high structural affinity with Iberiotoxin and Charybdotoxin that inhibit KCa2+ channels activity. According to several studies, it appears that Kaliotoxin-1 has a weak inhibitory effect on KCa2+ channels, but it is a potent and selective inhibitor of voltage-activated potassium channel (Kv1.1, Kv1.2, Kv1.3).

Technical specification

	Sequence :	H-GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK-OH (Cys8-Cys28; Cys14-Cys33; Cys18-Cys35)
	MW :	4149.89 g/mol
	Purity :	> 95%
	Counter-Ion :	TFA Salts
	Delivery format :	Lyophilized

Price

Product	Size	Price €	Price $
08KTX002-0.1 mg	0.1 mg	165 €	132 $
08KTX002-0.5 mg	0.5 mg	413 €	330 $
08KTX002-1 mg	1 mg	704 €	564 $
08KTX002-
08KTX002-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

Visit Smartox product page

Get a Quote

For Bulk Orders

Get a Quote