Hainantoxin-IV – Ion Channels and Transporters

Hainantoxin-IV (HNTX-IV) is a peptide that was originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang). It has been reported that this peptide is a potent antagonist of tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels (VGSCs). Hainantoxin-IV binds to TTX-S with an IC50value of 34 nM in adult rat dorsal root ganglion (DRG) neurons. Tetrodotoxin-resistant (TTX-R) voltage-gated sodium channels are not affected by Hainantoxin-IV. It probably interacts with the site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics.

Technical specification

	Sequence :	H-ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2 (Cys2-Cys17; Cys9-Cys24; ; Cys16-Cys31)
	MW :	3987.6 g/mol
	Purity :	> 95%
	Counter-Ion :	TFA Salts
	Delivery format :	Lyophilized

Price

Product	Size	Price €	Price $
12HTX001-0.1 mg	0.1 mg	220 €	176 $
12HTX001-0.5 mg	0.5 mg	660 €	528 $
12HTX001-1 mg	1 mg	1 045 €	836 $
12HTX001-
12HTX001-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

Hainantoxin-IV – Ion Channels and Transporters

Technical specification

Price

For Bulk Orders