GLP-1 (7-36) [Cys(Sulfocyanine5)] – Fluorescent Peptides

The native form of GLP-1 in humans is the GLP-1 (7-36) amide. GLP-1 (7-36) amide is highly unstable (half-life &lt-2 minutes) due to proteolytic degradation by the serine protease, dipeptidyl peptidase-IV (DPP-IV). DPP-IV cleaves the N-terminal histidine and alanine residues from GLP-1 to generate two equipotent forms: GLP-1 (9-37) and GLP-1 (9-36) amide. This degradation mitigates against the therapeutic use of GLP-1 itself, therefore DPP-IV-resistant peptide analogues have been developed and licensed for clinical use. Contains a sulfo-Cyanine5 fluorescent dye, an analogy of Cy5® and one of the most popular fluorophores. Sulfo-Cyanine5 is a red emitting fluorescent dye which is highly hydrophilic and water-soluble. Compatible with various equipment such as plate readers, microscopes, and imagers.

Technical specification

	Sequence :	H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR(C/Sulfocyanine5)-NH2
	MW :	4.162.9 g/mol
	Purity :	> 95%
	Counter-Ion :	TFA Salts
	Delivery format :	Lyophilized

Price

Product	Size	Price €	Price $
CRB1100802-0.1 mg	0.1 mg	385 €	308 $
CRB1100802-0.5 mg	0.5 mg	770 €	616 $
CRB1100802-1 mg	1 mg	963 €	770 $
CRB1100802-
CRB1100802-

Get a Quote

For Bulk Orders

Get a Quote