Crotamine – Ion Channels and Transporters

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

 

Technical specification

 KD20 peptide Sequence : H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH (Cys4-Cys36; Cys11-Cys30; Cys18-Cys37)
 KD20 peptide MW : 4883.82 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price €
Price $
CRO001-0.1 mg 0.1 mg 198 € 159 $
CRO001-0.5 mg 0.5 mg 578 € 462 $
CRO001-1 mg 1 mg 985 € 788 $
CRO001-
CRO001-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders