BDS-I – Ion Channels and Transporters

BDS-1 is a 43 amino acid peptide which was originally isolated from the venom of the sea anemona Anemonia Viridis. BDS-1 was originally described as a highly selective blocker of the rapidly inactivating voltage-gated potassium channel Kv3.4/ KCNC4, a potential therapeutic target for major CNS disorders (Alzheimer and Parkinson diseases). The toxin acts as gating modifiers, mainly by shifting the voltage-dependence of activation. Channel block occurs with high affinity (IC50 of 43 nM) and is rapid and reversible. BDS-1 also blocks the Kv3.1 and Kv3.2 channels albeit with a lower affinity (>200 nM). Finally, in a more recent study, it was demonstrated that BDS-1 is a selective gating activator of the Nav1.7 channel subtype, an important target for pain management. On the human isoform, modulation is witnessed by a drastic slowing of channel inactivation which occurs with an IC50 of 3 nM.

 

Technical specification

 KD20 peptide Sequence : H-AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH-OH (Cys4-Cys39; Cys6-Cys32; Cys22-Cys40)
 KD20 peptide MW : 2746.8 g/mol
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price €
Price $
BDS001-0.1 mg 0.1 mg 253 € 203 $
BDS001-0.5 mg 0.5 mg 737 € 590 $
BDS001-5 x 0.01 mg 5 x 0.01 mg 220 € 176 $
BDS001-
BDS001-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders