ADWX-1 – Ion Channels and Transporters

ADWX-1 is an optimised synthetic analog of the scorpion peptide BmKTx. ADWX-1 is known to block voltage-gated Kv1.3 channel with a high affinity (IC50 = 1.89 pM) and selectivity (340 fold greater affinity than for voltage-dependent ). ADWX-1 inhibits CD4+ CCR7– T-cell proliferation. ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of Kv1.3 channel and auto-immunity pathways

Technical specification

	Sequence :	H-VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK-OH (Cys7-Cys27; Cys13-Cys32; Cys17-Cys34)
	MW :	1777.05 g/mol
	Purity :	> 95%
	Counter-Ion :	TFA Salts
	Delivery format :	Lyophilized

Price

Product	Size	Price €	Price $
13ADW001-0.1 mg	0.1 mg	198 €	159 $
13ADW001-0.5 mg	0.5 mg	578 €	462 $
13ADW001-1 mg	1 mg	985 €	788 $
13ADW001-
13ADW001-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

Visit Smartox product page

Get a Quote

For Bulk Orders

Get a Quote