8xHis-ProTx-II – Ion Channels and Transporters

His-tagged ProTx-II (ProTx-2, Protoxin II) which is a toxin that was originally isolated from Thrixopelma pruriens (Peruvian green velvet tarantula). ProTx-II inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant voltage-gated sodium channels. ProTx-II inhibits activation by shifting the voltage-dependence of channel activation to more positive potentials. ProTx-II blocks Nav1.7 with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively. It also acts on Cav3.1/CACNA1G and interacts more weakly with the related T-Type channel Cav3.2/CACNA1H but potently inhibits the L-type calcium channel Cav1.2/CACNA1C. ProTx-II blocks action potential propagation in nociceptors. 8xHis-ProTx-II is a polyhistidine tagged version of ProTx-II.

 

Technical specification

 KD20 peptide Sequence : H-HHHHHHHHYCQKWMWTCDSERKCCEGMVCRLWCKKKLW-OH (Cys2-Cys16; Cys9-Cys21; Cys15-Cys25)
 KD20 peptide MW :
 KD20 peptide Purity : > 95%
 KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price €
Price $
PTH002-0.1 mg 0.1 mg 440 € 352 $
PTH002-0.5 mg 0.5 mg 1 320 € 1056 $
PTH002-
PTH002-
PTH002-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

For Bulk Orders