+33 (0) 4 76 45 21 20 contact@sb-peptide.com

ω-Hexatoxin-Hv1a – Ion Channels and Transporters

ω-Hexatoxin-Hv1a (ω-HXTX-Hv1a, ω-atracotoxin-Hv1a, ω-ACTX-Hv1a) has been isolated from the venom of Australian funnel web spiders. ω-Hexatoxin-Hv1a has been described to block mid-low- (M-LVA) and high-voltage-activated (HVA) insect calcium channel (Ca(v)) currents.

 

Technical specification

KD20 peptide Sequence : H-SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD-OH (Cys4-Cys18; Cys11-Cys22; Cys17-Cys36)
KD20 peptide MW : 4049.42 g/mol
KD20 peptide Purity : > 95%
KD20 peptide Counter-Ion : TFA Salts
Peptide library synthesis KD20 peptide Delivery format : Lyophilized

Price

 

Product Size Price €
 Price $
ACT001-0.1 mg 0.1 mg 330 € 264 $
ACT001-0.5 mg 0.5 mg 1 155 € 924 $
ACT001-
ACT001-
ACT001-

If you’d like to learn more about this toxin, visit our product page on our Smartox website—Our sister company specializing in the synthesis of complex toxins.

Visit Smartox product page
Contact Us
Get a Quote

For Bulk Orders

Get a Quote